![]() ![]() The antibody of any one of the preceding claims, wherein the IgG2 CH1ĪSTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS ![]() The amino acid sequence of a wildtype human IgG2 CH1 domain.Ĩ. Human IgG2 CH1 domain, or comprises an amino acid sequence that is at least The antibody of any one of the preceding claims, wherein the CH1 domain The antibody of any one of the preceding claims, wherein the CH1 domainħ. The antibody of any one of the preceding claims, wherein the hingeĪcid sequence of any one of SEQ ID NO: 8, 21-23, 126-132 or 134-147 or aĬomprises 1-3 amino acids inserted between CVE and CPP.Ħ. The antibody of any one of the preceding claims, wherein the hingeĥ. The antibody of claim 1 or 2, wherein the hinge contains one or moreĤ. The antibody of claim 1, wherein the hinge is a wildtype human IgG2Ĭomprises an amino acid sequence that is at least 95% identical to the aminoģ. Of the CH1, CH2, or CH3 domains is not of an IgG2 isotype.Ģ. Heavy chain constant region comprises a CH1 domain, a hinge, a CH2 domain, andĭomain in order from N- to C- terminus, wherein the hinge is of an IgG2 An antibody comprising a modified heavy chain constant region, wherein L'invention concerne également des procédés permettant d'améliorer certaines propriétés biologiques d'anticorps qui comprennent une charnière non-IgG2, comme l'internalisation, l'effet agoniste et l'effet antagoniste, lequel procédé comprend le remplacement de la charnière non-IgG2 de l'anticorps par une charnière d'IgG2. La région constante de chaîne lourde peut comprendre des séquences de domaine d'IgG humaine de type sauvage, ou des variants de ces séquences. Un exemple de région constante de chaîne lourde modifiée comprend une charnière d'IgG2 et trois domaines constants (à savoir, les domaines CH1, CH2 et CH3), dans lesquels un ou plusieurs des domaines de région constante sont d'un isotype non-IgG2 (par exemple, IgG1, IgG3 ou IgG4). L'invention concerne des régions constantes de chaîne lourde (désignées ici par "régions constantes de chaîne lourde modifiées"), ou des fragments fonctionnellement équivalents de celles-ci, qui améliorent les propriétés biologiques d'anticorps par rapport à celles des mêmes anticorps sous forme non modifiée. ![]() BRISTOL-MYERS SQUIBB COMPANY (United States of America).RAJPAL, ARVIND (United States of America).HAN, MICHALLE MINHUA (United States of America).SRINIVASAN, MOHAN (United States of America).LONBERG, NILS (United States of America).(51) International Patent Classification (IPC): ![]()
0 Comments
Leave a Reply. |
AuthorWrite something about yourself. No need to be fancy, just an overview. ArchivesCategories |